PDB entry 6b6j

View 6b6j on RCSB PDB site
Description: Structure of profilin Art v4
Class: allergen
Keywords: mugwort, plant protein, allergen, pollen
Deposited on 2017-10-02, released 2018-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Profilin-1
    Species: Artemisia vulgaris [TaxId:4220]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8H2C9 (4-135)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d6b6ja1, d6b6ja2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b6jA (A:)
    sgsgswqtyvddhlmcdiegtgqhltsaaifgtdgtvwaksasfpefkpneidaiikefn
    eagqlaptglflggakymviqgeagavirgkkgaggicikktgqamvfgiydepvapgqc
    nmvverlgdylldqgm