PDB entry 6b5j

View 6b5j on RCSB PDB site
Description: TNNI3K complexed with a 4,6-diaminopyrimidine
Class: transferase/transferase inhibitor
Keywords: kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-09-29, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.97 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase TNNI3K
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNI3K, CARK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b5ja_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase TNNI3K
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNI3K, CARK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b5jb_
  • Chain 'C':
    Compound: Serine/threonine-protein kinase TNNI3K
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNI3K, CARK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b5jc_
  • Chain 'D':
    Compound: Serine/threonine-protein kinase TNNI3K
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNI3K, CARK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b5jd_
  • Heterogens: CV4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b5jA (A:)
    ggdgsyvsvpsplgkiksmtkekadilllraglpshfhlqlseiefheiigsgsfgkvyk
    grcrnkivaikryrantycsksdvdmfcrevsilcqlnhpcviqfvgaclndpsqfaivt
    qyisggslfsllheqkrildlqskliiavdvakgmeylhnltqpiihrdlnshnillyed
    ghavvadfgesrflqsldednmtkqpgnlrwmapevftqctrytikadvfsyalclweil
    tgeipfahlkpaaaaadmayhhirppigysipkpissllirgwnacpegrpefsevvmkl
    eeclcnielms
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b5jA (A:)
    illlraglpshfhlqlseiefheiigsfgkvykgrcrnkivaikryrsdvdmfcrevsil
    cqlnhpcviqfvgaclndpsqfaivtqyisggslfsllheqkrildlqskliiavdvakg
    meylhnltqpiihrdlnshnillyedghavvadfgesrflqsgnlrwmapevftqctryt
    ikadvfsyalclweiltgeipfahlkpaaaaadmayhhirppigysipkpissllirgwn
    acpegrpefsevvmkleeclcni
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6b5jB (B:)
    ggdgsyvsvpsplgkiksmtkekadilllraglpshfhlqlseiefheiigsgsfgkvyk
    grcrnkivaikryrantycsksdvdmfcrevsilcqlnhpcviqfvgaclndpsqfaivt
    qyisggslfsllheqkrildlqskliiavdvakgmeylhnltqpiihrdlnshnillyed
    ghavvadfgesrflqsldednmtkqpgnlrwmapevftqctrytikadvfsyalclweil
    tgeipfahlkpaaaaadmayhhirppigysipkpissllirgwnacpegrpefsevvmkl
    eeclcnielms
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b5jB (B:)
    illlraglpshfhlqlseiefheiigsgsfgkvykgrcrnkivaikryrksdvdmfcrev
    silcqlnhpcviqfvgaclndpsqfaivtqyisggslfsllheqkrildlqskliiavdv
    akgmeylhnltqpiihrdlnshnillyedghavvadfgesrflqnlrwmapevftqctry
    tikadvfsyalclweiltgeipfahlkpaaaaadmayhhirppigysipkpissllirgw
    nacpegrpefsevvmkleeclcni
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6b5jC (C:)
    ggdgsyvsvpsplgkiksmtkekadilllraglpshfhlqlseiefheiigsgsfgkvyk
    grcrnkivaikryrantycsksdvdmfcrevsilcqlnhpcviqfvgaclndpsqfaivt
    qyisggslfsllheqkrildlqskliiavdvakgmeylhnltqpiihrdlnshnillyed
    ghavvadfgesrflqsldednmtkqpgnlrwmapevftqctrytikadvfsyalclweil
    tgeipfahlkpaaaaadmayhhirppigysipkpissllirgwnacpegrpefsevvmkl
    eeclcnielms
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b5jC (C:)
    glpshfhlqlseiefheiigsgfgkvykgrcrnkivaikrysdvdmfcrevsilcqlnhp
    cviqfvgaclndpsqfaivtqyisggslfsllheqkrildlqskliiavdvakgmeylhn
    ltqpiihrdlnshnillyedghavvadfgesrflqslqpgnlrwmapevftqctrytika
    dvfsyalclweiltgeipfahlkpaaaaadmayhhirppigysipkpissllirgwnacp
    egrpefsevvmkleeclcni
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6b5jD (D:)
    ggdgsyvsvpsplgkiksmtkekadilllraglpshfhlqlseiefheiigsgsfgkvyk
    grcrnkivaikryrantycsksdvdmfcrevsilcqlnhpcviqfvgaclndpsqfaivt
    qyisggslfsllheqkrildlqskliiavdvakgmeylhnltqpiihrdlnshnillyed
    ghavvadfgesrflqsldednmtkqpgnlrwmapevftqctrytikadvfsyalclweil
    tgeipfahlkpaaaaadmayhhirppigysipkpissllirgwnacpegrpefsevvmkl
    eeclcnielms
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b5jD (D:)
    lpshfhlqlseiefheiigsgsfgkvykgrcrnkivaikrysdvdmfcrevsilcqlnhp
    cviqfvgaclndpsqfaivtqyisggslfsllheqkrildlqskliiavdvakgmeylhn
    ltqpiihrdlnshnillyedghavvadfgesrflqsgnlrwmapevftqctrytikadvf
    syalclweiltgeipfahlkpaaaaadmayhhirppigysipkpissllirgwnacpegr
    pefsevvmkleeclcni