PDB entry 6b4s

View 6b4s on RCSB PDB site
Description: Crystal Structure of Brazil nut (Bertholletia excelsa) allergen Ber e 2
Class: allergen
Keywords: seed storage protein, allergen, Brazil nut, 11S globulin
Deposited on 2017-09-27, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 11S globulin
    Species: Bertholletia excelsa [TaxId:3645]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84ND2 (0-425)
      • conflict (425)
    Domains in SCOPe 2.07: d6b4sa1, d6b4sa2
  • Chain 'B':
    Compound: 11S globulin
    Species: Bertholletia excelsa [TaxId:3645]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84ND2 (Start-425)
      • conflict (425)
    Domains in SCOPe 2.07: d6b4sb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b4sA (A:)
    yecriqrltaqepqyrleaeagvsevwdytdqqfrcagvaalrntirpqglllpvytnap
    klyyvtqgrgilgvlmpgcpetfqsmsqfqgsreqeeergrfqdqhqkvhhlkkgdiiai
    pagvalwcyndgdedlvtvlvqhtasdlnqldqnprhfflagniqrsqkqrgeryglrgg
    qqiladnvfkgfnmealadvlgfgmdtetarkvrgeddqrghivrveqglkvirpprire
    eleqqegggyngleeticsatfiqnidnpaeadfynpragrlttvnslkvpiltflqlsa
    mkgvlyenammaplwrlnansvvyavrgearvqivdhrgetvfddnlregqmvvvpqnfv
    vvkqagsrgfewvvfntndnalfstaagrtsplrgipvgvlanayrlsqeearriklnrd
    eavlfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b4sA (A:)
    yecriqrltaqepqyrleaeagvsevwdytdqqfrcagvaalrntirpqglllpvytnap
    klyyvtqgrgilgvlmpgcpetfqsdqhqkvhhlkkgdiiaipagvalwcyndgdedlvt
    vlvqhtasdlnqldqnprhfflagnladnvfkgfnmealadvlgftetarkvrgeddqrg
    hivrveqglkvirpicsatfiqnidnpaeadfynpragrlttvnslkvpiltflqlsamk
    gvlyenammaplwrlnansvvyavrgearvqivdhrgetvfddnlregqmvvvpqnfvvv
    kqagsrgfewvvfntndnalfstaagrtsplrgipvgvlanayrlsqeearriklnrdea
    vlfn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6b4sB (B:)
    yecriqrltaqepqyrleaeagvsevwdytdqqfrcagvaalrntirpqglllpvytnap
    klyyvtqgrgilgvlmpgcpetfqsmsqfqgsreqeeergrfqdqhqkvhhlkkgdiiai
    pagvalwcyndgdedlvtvlvqhtasdlnqldqnprhfflagniqrsqkqrgeryglrgg
    qqiladnvfkgfnmealadvlgfgmdtetarkvrgeddqrghivrveqglkvirpprire
    eleqqegggyngleeticsatfiqnidnpaeadfynpragrlttvnslkvpiltflqlsa
    mkgvlyenammaplwrlnansvvyavrgearvqivdhrgetvfddnlregqmvvvpqnfv
    vvkqagsrgfewvvfntndnalfstaagrtsplrgipvgvlanayrlsqeearriklnrd
    eavlfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b4sB (B:)
    ecriqrltaqepqyrleaeagvsevwdytdqqfrcagvaalrntirpqglllpvytnapk
    lyyvtqgrgilgvlmpgcpetfqsdqhqkvhhlkkgdiiaipagvalwcyndgdedlvtv
    lvqhtasdlnqldqnprhfflagnladnvfkgfnmealadvlgarkvrgqrghivrvvir
    picsatfiqnidnpaeadfynpragrlttvnslkvpiltflqlsamkgvlyenammaplw
    rlnansvvyavrgearvqivdhrgetvfddnlregqmvvvpqnfvvvkqagsrgfewvvf
    ntndnalfstaagrtsplrgipvgvlanayrlsqeearriklnrdeavlfn