PDB entry 6b3v

View 6b3v on RCSB PDB site
Description: PANK3 complex with compound PZ-2891
Class: transferase/inhibitor
Keywords: PANK, Inhibitor, Complex, Transferase, Pantothenate kinase, TRANSFERASE-INHIBITOR complex
Deposited on 2017-09-25, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantothenate kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PANK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H999 (19-End)
      • expression tag (18)
    Domains in SCOPe 2.07: d6b3va1, d6b3va2, d6b3va3
  • Heterogens: 7DQ, ANP, MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b3vA (A:)
    mgsshhhhhhssglvprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyl
    tsnvaygstgirdvhlelkdltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlc
    atgggaykfekdfrtignlhlhkldeldclvkgllyidsvsfngqaecyyfanaseperc
    qkmpfnlddpypllvvnigsgvsilavhskdnykrvtgtslgggtflglcslltgcesfe
    ealemaskgdstqadklvrdiyggdyerfglpgwavassfgnmiykekresvskedlara
    tlvtitnnigsvarmcavnekinrvvfvgnflrvntlsmkllayaldywskgqlkalfle
    hegyfgavgallglpnfsdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b3vA (A:)
    spwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnvaygstgirdvhlel
    kdltlfgrrgnlhfirfptqdlptfiqmgrdtvlcatgggaykfekdfrtignlhlhkld
    eldclvkgllyidsvsfngqaecyyfanasepercqkmpfnlddpypllvvnigsgvsil
    avhskdnykrvtgtslgggtflglcslltgcesfeealemaskgdstqadklvrdiyggd
    yerfglpgwavassfgnmiykekresvskedlaratlvtitnnigsvarmcavnekinrv
    vfvgnflrvntlsmkllayaldywskgqlkalflehegyfgavgallglpnf