PDB entry 6b3s

View 6b3s on RCSB PDB site
Description: Crystal structure of the Fab fragment of necitumumab (Fab11F8) in complex with domain III from a cetuximab resistant variant of EGFR (sEGFRd3-S468R)
Class: TRANSFERASE/immune system
Keywords: Therapeutic antibody, Cetuximab resistance, Somatic mutation, Colorectal cancer, TRANSFERASE, TRANSFERASE-immune system complex
Deposited on 2017-09-23, released 2017-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (4-End)
      • expression tag (3)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d6b3sa1, d6b3sa2
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (4-End)
      • expression tag (2-3)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d6b3sb1, d6b3sb2, d6b3sb3
  • Chain 'C':
    Compound: Necitumumab Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B3S (0-End)
  • Chain 'D':
    Compound: Necitumumab Fab Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B3S (0-212)
    Domains in SCOPe 2.07: d6b3sd1, d6b3sd2
  • Chain 'E':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (4-End)
      • expression tag (2-3)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d6b3se1, d6b3se2, d6b3se3
  • Chain 'F':
    Compound: Necitumumab Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B3S (0-End)
  • Chain 'G':
    Compound: Necitumumab Fab Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B3S (0-212)
    Domains in SCOPe 2.07: d6b3sg1, d6b3sg2
  • Chain 'H':
    Compound: Necitumumab Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B3S (0-End)
  • Chain 'I':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (4-End)
      • expression tag (2-3)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d6b3si1, d6b3si2, d6b3si3
  • Chain 'J':
    Compound: Necitumumab Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B3S (0-End)
  • Chain 'K':
    Compound: Necitumumab Fab Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B3S (0-212)
    Domains in SCOPe 2.07: d6b3sk1, d6b3sk2
  • Chain 'L':
    Compound: Necitumumab Fab Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B3S (0-212)
    Domains in SCOPe 2.07: d6b3sl1, d6b3sl2
  • Heterogens: NAG, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b3sA (A:)
    leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
    eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
    rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiirnrgensckatgqvchalc
    spegcwgpeprdcvscrnvsrgrecvdkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b3sA (A:)
    kkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeld
    ilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrsl
    keisdgdviisgnknlcyantinwkklfgtsgqktkiirnrgensckatgqvchalcspe
    gcwgpeprdcv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6b3sB (B:)
    leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
    eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
    rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiirnrgensckatgqvchalc
    spegcwgpeprdcvscrnvsrgrecvdkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b3sB (B:)
    ekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqel
    dilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrs
    lkeisdgdviisgnknlcyantinwkklfgtsgqktkiirnrgensckatgqvchalcsp
    egcwgpeprdcvsc
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b3sD (D:)
    eivmtqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyychqygstpltfgggtkaeikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrga
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6b3sE (E:)
    leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
    eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
    rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiirnrgensckatgqvchalc
    spegcwgpeprdcvscrnvsrgrecvdkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b3sE (E:)
    ekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqel
    dilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrs
    lkeisdgdviisgnknlcyantinwkklfgtsgqktkiirnrgensckatgqvchalcsp
    egcwgpeprdcvsc
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b3sG (G:)
    eivmtqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyychqygstpltfgggtkaeikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrga
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6b3sI (I:)
    leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
    eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
    rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiirnrgensckatgqvchalc
    spegcwgpeprdcvscrnvsrgrecvdkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b3sI (I:)
    ekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqel
    dilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrs
    lkeisdgdviisgnknlcyantinwkklfgtsgqktkiirnrgensckatgqvchalcsp
    egcwgpeprdcvsc
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b3sK (K:)
    eivmtqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyychqygstpltfgggtkaeikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrga
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b3sL (L:)
    eivmtqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyychqygstpltfgggtkaeikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrga