PDB entry 6b2p

View 6b2p on RCSB PDB site
Description: Dual Inhibition of the Essential Protein Kinases A and B in Mycobacterium tuberculosis
Class: transferase/inhibitor
Keywords: kinase, drug design, tuberculosis, TRANSFERASE-INHIBITOR complex
Deposited on 2017-09-20, released 2018-02-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase pknb
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: pknB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6b2pa_
  • Heterogens: CJJ

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b2pA (A:)
    mttpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrrea
    qnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraievia
    dacqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavigta
    qylspeqargdsvdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarh
    eglsadldavvlkalaknpenryqtaaemradlvrvhng
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b2pA (A:)
    pshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqna
    aalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviadac
    qalnfshqngiihrdvkpanimisatnavkvmdfgtaqylspeqargdsvdarsdvyslg
    cvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkalaknpenry
    qtaaemradlvrvhn