PDB entry 6b2k

View 6b2k on RCSB PDB site
Description: E45A/R132T mutant of HIV-1 capsid protein
Class: viral protein
Keywords: HIV-1 capsid protein, hexamer, E45A/R132T mutant, VIRAL PROTEIN
Deposited on 2017-09-20, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 capsid protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DRA0 (0-End)
      • engineered mutation (44)
      • engineered mutation (131)
    Domains in SCOPe 2.07: d6b2ka1, d6b2ka2
  • Heterogens: IOD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b2kA (A:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsagatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiyktwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b2kA (A:)
    pivqmvhqaisprtlnawvkvveekafspevipmfsalsagatpqdlntmlntvgghqaa
    mqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppip
    vgeiyktwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwm
    tetllvqnanpdcktilkalgpgatleemmtacqgv