PDB entry 6b2f

View 6b2f on RCSB PDB site
Description: Phosphotriesterase variant S5 + TS analogue
Class: hydrolase
Keywords: phosphotriesterase, organophosphate hydrolase, epistasis, directed evolution, laboratory evolution, HYDROLASE
Deposited on 2017-09-20, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotriesterase
    Species: Brevundimonas diminuta [TaxId:293]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A060GYS1
      • conflict (183)
      • conflict (200)
      • conflict (221)
      • conflict (260)
      • conflict (273)
      • conflict (287)
    Domains in SCOPe 2.07: d6b2fa_
  • Chain 'G':
    Compound: phosphotriesterase
    Species: Brevundimonas diminuta [TaxId:293]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A060GYS1 (0-End)
      • conflict (183)
      • conflict (200)
      • conflict (221)
      • conflict (238)
      • conflict (260)
      • conflict (273)
      • conflict (287)
    Domains in SCOPe 2.07: d6b2fg_
  • Heterogens: HLN, ZN, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b2fA (A:)
    mgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrrara
    agvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflr
    eiqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqq
    aaileseglspsrvcighsdatddlsyltalaargyligldsiphsaiglednasasahl
    girswqtrallikalidqgytkqilvsndwlfgissyvtnimdvmdsgnpdgmafiplrv
    ipflrekgipqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b2fA (A:)
    gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
    gvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflre
    iqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqqa
    aileseglspsrvcighsdatddlsyltalaargyligldsiphsaiirswqtrallika
    lidqgytkqilvsndwlfgissyvtnimdvmdsgnpdgmafiplrvipflrekgipqetl
    agitvtnparflsptlra
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6b2fG (G:)
    mgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrrara
    agvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflr
    eiqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqq
    aaileseglspsrvcighsdatddlsyltalaargyligldsiphsaiglednasasahl
    girswqtrallikalidqgytkqilvsndwlfgissyvtnimdvmdsgnpdgmafiplrv
    ipflrekgipqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b2fG (G:)
    mgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrrara
    agvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflr
    eiqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqq
    aaileseglspsrvcighsdatddlsyltalaargyligldsiphsaisasahlgirswq
    trallikalidqgytkqilvsndwlfgissyvtnimdvmdsgnpdgmafiplrvipflre
    kgipqetlagitvtnparflsptlra