PDB entry 6b2a

View 6b2a on RCSB PDB site
Description: Crystal structure of fluoride channel Fluc Ec2 F80M Mutant
Class: transport protein
Keywords: alpha helix, ion channel, membrane protein, TRANSPORT PROTEIN
Deposited on 2017-09-19, released 2017-10-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluoride ion transporter CrcB
    Species: Escherichia coli [TaxId:562]
    Gene: crcB, A4T40_27000, AC789_145pl00540, AKG99_27195, BET08_05210, BK251_13005, BK292_28205, BK334_22235, BK373_23795, BUE82_27975, ECONIH1_26550, ECS286_0026, MJ49_27125, pCTXM15_EC8_00123, pO103_22
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6J5N4 (Start-125)
      • engineered mutation (24)
      • engineered mutation (79)
  • Chain 'B':
    Compound: Fluoride ion transporter CrcB
    Species: Escherichia coli [TaxId:562]
    Gene: crcB, A4T40_27000, AC789_145pl00540, AKG99_27195, BET08_05210, BK251_13005, BK292_28205, BK334_22235, BK373_23795, BUE82_27975, ECONIH1_26550, ECS286_0026, MJ49_27125, pCTXM15_EC8_00123, pO103_22
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6J5N4 (0-End)
      • engineered mutation (24)
      • engineered mutation (79)
  • Chain 'C':
    Compound: monobody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B2A (0-95)
    Domains in SCOPe 2.06: d6b2ac_
  • Chain 'D':
    Compound: monobody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B2A (0-95)
    Domains in SCOPe 2.06: d6b2ad_
  • Heterogens: NA, DMU, F, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6b2aC (C:)
svssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstati
sglkpgvdytitvytmyysysdlysysspisinyrt

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6b2aD (D:)
svssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstati
sglkpgvdytitvytmyysysdlysysspisinyrt