PDB entry 6b22

View 6b22 on RCSB PDB site
Description: Crystal structure OXA-24 beta-lactamase complexed with WCK 4234 by co-crystallization
Class: HYDROLASE/HYDROLASE Inhibitor
Keywords: Inhibitor, complex, HYDROLASE, HYDROLASE-HYDROLASE Inhibitor complex
Deposited on 2017-09-19, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: blaOXA-33, bla-OXA-40, blaOXA-24, blaOXA-40, oxa-24, oxa40
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b22a_
  • Heterogens: C8Y, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b22A (A:)
    hissqqhekaiksyfdeaqtqgviiikegknlstygnalarankeyvpastfkmlnalig
    lenhkattneifkwdgkkrtypmwekdmtlgeamalsavpvyqelarrtglelmqkevkr
    vnfgntnigtqvdnfwlvgplkitpvqevnfaddlahnrlpfkletqeevkkmllikevn
    gskiyaksgwgmgvtpqvgwltgwveqangkkipfslnlemkegmsgsirneitykslen
    lgii