PDB entry 6b21

View 6b21 on RCSB PDB site
Description: Crystal structure of AmtB from E. coli bound to TopFluor cardiolipin
Class: membrane protein
Keywords: ammonia channel, AmtB, cardiolipin, transporter, MEMBRANE PROTEIN
Deposited on 2017-09-19, released 2018-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.4499999999999997 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ammonia channel
    Species: Escherichia coli [TaxId:83333]
    Gene: amtB, ybaG, b0451, JW0441
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69681 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d6b21a1, d6b21a2
  • Heterogens: C9V, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b21A (A:)
    gasvadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvcilwv
    vygyslafgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivgala
    erirfsavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglvgay
    ligkrvgfgkeafkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvvataa
    ailgwifgewalrgkpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglwgvt
    mlkrllrvddpcdvfgvhgvcgivgcimtgifaasslggvgfaegvtmghqllvqlesia
    itivwsgvvafigykladltvglrvpeeqeregldvnshgenayna
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b21A (A:)
    gasvadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvcilwv
    vygyslafgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivgala
    erirfsavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglvgay
    ligkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvvataaailgwifgew
    alrgkpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglwgvtmlkrpcdvfg
    vhgvcgivgcimtgifaasslggvgfaegvtmghqllvqlesiaitivwsgvvafigykl
    adltvglrv