PDB entry 6b20

View 6b20 on RCSB PDB site
Description: Crystal structure of a complex between G protein beta gamma dimer and an inhibitory Nanobody regulator
Class: signaling protein
Keywords: Beta propeller, G protein, G protein coupled receptor-signaling, SIGNALING PROTEIN
Deposited on 2017-09-19, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62871 (0-337)
      • engineered mutation (68)
    Domains in SCOPe 2.07: d6b20a_
  • Chain 'B':
    Compound: Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62871 (0-337)
      • engineered mutation (68)
    Domains in SCOPe 2.07: d6b20b_
  • Chain 'C':
    Compound: Guanine nucleotide-binding protein G(T) subunit gamma-T1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b20c_
  • Chain 'D':
    Compound: Guanine nucleotide-binding protein G(T) subunit gamma-T1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b20d_
  • Chain 'E':
    Compound: Nanobody against G protein beta gamma dimer
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B20 (0-113)
    Domains in SCOPe 2.07: d6b20e_
  • Chain 'F':
    Compound: Nanobody against G protein beta gamma dimer
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B20 (0-113)
    Domains in SCOPe 2.07: d6b20f_
  • Heterogens: UNX, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b20A (A:)
    eldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiyamh
    wgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldnics
    iynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttftg
    htgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngnafa
    tgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdalka
    dragvlaghdnrvsclgvtddgmavatgswdsflkiwn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b20B (B:)
    eldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiyamh
    wgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldnics
    iynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttftg
    htgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngnafa
    tgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdalka
    dragvlaghdnrvsclgvtddgmavatgswdsflkiwn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6b20C (C:)
    edltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgipedknpfke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b20C (C:)
    ekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgipedknpfke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6b20D (D:)
    edltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgipedknpfke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b20D (D:)
    edltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgipedknpfk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b20E (E:)
    qvqlvesggglvqaggslrlscaasgsifsinamgwyrqapgkqrelvaaitrggrtnya
    dsvkgrftlsrdnakntvylqmnslkpedtavyycnvgrsrgywgqgtqvtvss
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b20F (F:)
    qvqlvesggglvqaggslrlscaasgsifsinamgwyrqapgkqrelvaaitrggrtnya
    dsvkgrftlsrdnakntvylqmnslkpedtavyycnvgrsrgywgqgtqvtvss