PDB entry 6b1y

View 6b1y on RCSB PDB site
Description: Crystal structure KPC-2 beta-lactamase complexed with WCK 5153 by co-crystallization
Class: HYDROLASE/HYDROLASE Inhibitor
Keywords: Inhibitor, complex, HYDROLASE, HYDROLASE-HYDROLASE Inhibitor complex
Deposited on 2017-09-19, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbapenem-hydrolyzing beta-lactamase KPC
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: bla, kpc, kpc1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b1ya_
  • Chain 'B':
    Compound: Carbapenem-hydrolyzing beta-lactamase KPC
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: bla, kpc, kpc1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b1yb_
  • Heterogens: CD7, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b1yA (A:)
    ataltnlvaepfakleqdfggsigvyamdtgsgatvsyraeerfplcssfkgflaaavla
    rsqqqaglldtpirygknalvpwspisekylttgmtvaelsaaavqysdnaaanlllkel
    ggpagltafmrsigdttfrldrwelelnsaipgdardtsspravteslqkltlgsalaap
    qrqqfvdwlkgnttgnhriraavpadwavgdktgtcgvygtandyavvwptgrapivlav
    ytrapnkddkhseaviaaaarlaleglg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6b1yB (B:)
    ataltnlvaepfakleqdfggsigvyamdtgsgatvsyraeerfplcssfkgflaaavla
    rsqqqaglldtpirygknalvpwspisekylttgmtvaelsaaavqysdnaaanlllkel
    ggpagltafmrsigdttfrldrwelelnsaipgdardtsspravteslqkltlgsalaap
    qrqqfvdwlkgnttgnhriraavpadwavgdktgtcgvygtandyavvwptgrapivlav
    ytrapnkddkhseaviaaaarlaleglg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b1yB (B:)
    ltnlvaepfakleqdfggsigvyamdtgsgatvsyraeerfplcssfkgflaaavlarsq
    qqaglldtpirygknalvpwspisekylttgmtvaelsaaavqysdnaaanlllkelggp
    agltafmrsigdttfrldrwelelnsaipgdardtsspravteslqkltlgsalaapqrq
    qfvdwlkgnttgnhriraavpadwavgdktgtcgvygtandyavvwptgrapivlavytr
    apnkddkhseaviaaaarlaleglg