PDB entry 6b07

View 6b07 on RCSB PDB site
Description: Crystal structure of CfFPPS2, a lepidopteran type-II farnesyl diphosphate synthase, complexed with [1-phosphono-2-(1-propylpyridin-2-yl)ethyl]phosphonic acid (inhibitor 1d)
Class: transferase/transferase inhibitor
Keywords: juvenile hormone, farnesyl diphosphate synthase, inhibitor design, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-09-13, released 2017-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Farnesyl Diphosphate Synthase
    Species: Choristoneura fumiferana [TaxId:7141]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b07a_
  • Chain 'B':
    Compound: Farnesyl Diphosphate Synthase
    Species: Choristoneura fumiferana [TaxId:7141]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b07b_
  • Chain 'C':
    Compound: Farnesyl Diphosphate Synthase
    Species: Choristoneura fumiferana [TaxId:7141]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b07c_
  • Heterogens: C6M, MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b07A (A:)
    tkkesfedvlpsilntittnseltevpevanwlkkvleynlaggkkarglttlfayemle
    kpeniteetiylaktlgwcveilqgflvmlddimdgsttrrgvpcwyqlpevglaavnds
    slmfssifyvlhahfadkkiytnlvelfneslmhtsigqhldvtmerrqksdyslftier
    ynaivkyktayytyqlpvclgmllanisdpvlhqkaedmcleigkffqiqddyidcygde
    sltgkmgtdiqeakcswlavmalqrcsasqkivfttcygskepahierikelykqlqlpe
    lyaqeetrmyeslikqahglpselspalfvrlihmiykrnh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6b07B (B:)
    tkkesfedvlpsilntittnseltevpevanwlkkvleynlaggkkarglttlfayemle
    kpeniteetiylaktlgwcveilqgflvmlddimdgsttrrgvpcwyqlpevglaavnds
    slmfssifyvlhahfadkkiytnlvelfneslmhtsigqhldvtmerrqksdyslftier
    ynaivkyktayytyqlpvclgmllanisdpvlhqkaedmcleigkffqiqddyidcygde
    sltgkmgtdiqeakcswlavmalqrcsasqkivfttcygskepahierikelykqlqlpe
    lyaqeetrmyeslikqahglpselspalfvrlihmiykrnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b07B (B:)
    kkesfedvlpsilntittnseltevpevanwlkkvleynlaggkkarglttlfayemlek
    peniteetiylaktlgwcveilqgflvmlddimdgsttrrgvpcwyqlpevglaavndss
    lmfssifyvlhahfadkkiytnlvelfneslmhtsigqhldvtmrqksdyslftieryna
    ivkyktayytyqlpvclgmllanisdpvlhqkaedmcleigkffqiqddyidcygdeslt
    gkmgtdiqeakcswlavmalqrcsasqkivfttcygskepahierikelykqlqlpelya
    qeetrmyeslikqahglpselspalfvrlihmiykrnh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6b07C (C:)
    tkkesfedvlpsilntittnseltevpevanwlkkvleynlaggkkarglttlfayemle
    kpeniteetiylaktlgwcveilqgflvmlddimdgsttrrgvpcwyqlpevglaavnds
    slmfssifyvlhahfadkkiytnlvelfneslmhtsigqhldvtmerrqksdyslftier
    ynaivkyktayytyqlpvclgmllanisdpvlhqkaedmcleigkffqiqddyidcygde
    sltgkmgtdiqeakcswlavmalqrcsasqkivfttcygskepahierikelykqlqlpe
    lyaqeetrmyeslikqahglpselspalfvrlihmiykrnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b07C (C:)
    sfedvlpsilntittnseltevpevanwlkkvleynlaggkkarglttlfayemlekpen
    iteetiylaktlgwcveilqgflvmlddimdgsttrrgvpcwyqlpevglaavndsslmf
    ssifyvlhahfadkkiytnlvelfneslmhtsigqhldvtmersdyslftierynaivky
    ktayytyqlpvclgmllanisdpvlhqkaedmcleigkffqiqddyidcygdesltgkmg
    tdiqeakcswlavmalqrcsasqkivfttcygskepahierikelykqlqlpelyaqeet
    rmyeslikqahglpselspalfvrlihmiykrnh