PDB entry 6azw

View 6azw on RCSB PDB site
Description: IDO1/FXB-001116 crystal structure
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: IDO1/FXB-001116 crystal structure, oxidoreductase-oxidoreductase inhibitor complex
Deposited on 2017-09-13, released 2018-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 2.7800000000000002 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Indoleamine 2,3-dioxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IDO1, IDO, INDO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14902 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d6azwa_
  • Chain 'B':
    Compound: Indoleamine 2,3-dioxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IDO1, IDO, INDO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14902 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d6azwb_
  • Heterogens: C51

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6azwA (A:)
    miskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidh
    ltdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadc
    vlanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamq
    mqerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvy
    egfwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcs
    lesnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpkenktse
    dpskleakgtggtdlmnflktvrstteksllkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6azwA (A:)
    miskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidh
    ltdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadc
    vlanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamq
    mqerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvy
    egfwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcs
    lesnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpggtdlmn
    flktvrstteksllk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6azwB (B:)
    miskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidh
    ltdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadc
    vlanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamq
    mqerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvy
    egfwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcs
    lesnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpkenktse
    dpskleakgtggtdlmnflktvrstteksllkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6azwB (B:)
    miskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidh
    ltdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadc
    vlanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamq
    mqerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvy
    egfwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcs
    lesnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqgtdlmnfl
    ktvrstteksllk