PDB entry 6azu

View 6azu on RCSB PDB site
Description: Holo IDO1 crystal structure
Class: oxidoreductase
Keywords: holoenzyme IDO1, OXIDOREDUCTASE
Deposited on 2017-09-13, released 2018-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Indoleamine 2,3-dioxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IDO1, IDO, INDO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6azua_
  • Chain 'B':
    Compound: Indoleamine 2,3-dioxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IDO1, IDO, INDO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6azub_
  • Chain 'C':
    Compound: Indoleamine 2,3-dioxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IDO1, IDO, INDO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6azuc_
  • Chain 'D':
    Compound: Indoleamine 2,3-dioxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IDO1, IDO, INDO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6azud_
  • Heterogens: HEM, SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6azuA (A:)
    gshmenswtiskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrervek
    lnmlsidhltdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelp
    pilvyadcvlanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikvi
    ptvfkamqmqerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnp
    qlsdglvyegfwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrympp
    ahrnflcslesnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqq
    pkenktsedpskleakgtggtdlmnflktvrstteksllkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6azuA (A:)
    skeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhlt
    dhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcvl
    anwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqmq
    erdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyeg
    fwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcsle
    snpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqgtdlmnflktv
    rstteksllk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6azuB (B:)
    gshmenswtiskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrervek
    lnmlsidhltdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelp
    pilvyadcvlanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikvi
    ptvfkamqmqerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnp
    qlsdglvyegfwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrympp
    ahrnflcslesnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqq
    pkenktsedpskleakgtggtdlmnflktvrstteksllkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6azuB (B:)
    skeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhlt
    dhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcvl
    anwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqmq
    erdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyeg
    fwedpkefaggsagqssvfqcfdvllgiqqtahaaqflqdmrrymppahrnflcslesnp
    svrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqtdlmnflktvrstt
    eksllk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6azuC (C:)
    gshmenswtiskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrervek
    lnmlsidhltdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelp
    pilvyadcvlanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikvi
    ptvfkamqmqerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnp
    qlsdglvyegfwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrympp
    ahrnflcslesnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqq
    pkenktsedpskleakgtggtdlmnflktvrstteksllkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6azuC (C:)
    skeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhlt
    dhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcvl
    anwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqmq
    erdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyeg
    fwedpkefaggsagqssvfqcfdvllgiqqghaaqflqdmrrymppahrnflcslesnps
    vrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqgtdlmnflktvrstt
    eksllk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6azuD (D:)
    gshmenswtiskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrervek
    lnmlsidhltdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelp
    pilvyadcvlanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikvi
    ptvfkamqmqerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnp
    qlsdglvyegfwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrympp
    ahrnflcslesnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqq
    pkenktsedpskleakgtggtdlmnflktvrstteksllkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6azuD (D:)
    skeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhlt
    dhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcvl
    anwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqmq
    erdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyeg
    fwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcsle
    snpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqgtdlmnflktv
    rstteksllk