PDB entry 6azd

View 6azd on RCSB PDB site
Description: Crystal structure of Physcomitrella patens KAI2-like H
Class: hydrolase
Keywords: alpha/beta hydrolase, strigolactone binding, HYDROLASE
Deposited on 2017-09-11, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PpKAI2-like H
    Species: Physcomitrella patens subsp. patens [TaxId:3218]
    Gene: PHYPADRAFT_184560
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6azda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6azdA (A:)
    gpmpspllsthnvtvlgnrsdpvvvlghglgtdqsvwkytvpslvnqnfqvvlydtmgag
    stetsdfnfkrysslqghvddllaildeleiencvyvghsmsgmigvlaslerpdlfrkl
    illsasprylndssyyggfeqedldqlfssmrsnfsawvsgfataavgtdihdeavqefs
    stfismrpdvalrtsqfvfqsdfrsilsevtvpchivqsrkdiavpievaeylrcnlggw
    tsvdilqtdghlpqlscpelvvpvllhcids
    

    Sequence, based on observed residues (ATOM records): (download)
    >6azdA (A:)
    spllsthnvtvlgnrsdpvvvlghglgtdqsvwkytvpslvnqnfqvvlydtmgagstet
    sdfnfkrysslqghvddllaildeleiencvyvghsmsgmigvlaslerpdlfrklills
    asprylndssyyggfeqedldqlfssmrsnfsawvsgfataavgtdihdeavqefsstfi
    smrpdvalrtsqfvfqsdfrsilsevtvpchivqsrkdiavpievaeylrcnlggwtsvd
    ilqtdghlpqlscpelvvpvllhcid