PDB entry 6azc

View 6azc on RCSB PDB site
Description: Crystal structure of Physcomitrella patens KAI2-like E S166A
Class: hydrolase
Keywords: alpha/beta hydrolase, strigolactone binding, HYDROLASE
Deposited on 2017-09-11, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pp-KAI2-like E
    Species: Physcomitrella patens subsp. patens [TaxId:3218]
    Gene: PHYPADRAFT_215526
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9ST85
      • engineered mutation (167)
    Domains in SCOPe 2.07: d6azca_
  • Chain 'B':
    Compound: Pp-KAI2-like E
    Species: Physcomitrella patens subsp. patens [TaxId:3218]
    Gene: PHYPADRAFT_215526
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9ST85
      • engineered mutation (167)
    Domains in SCOPe 2.07: d6azcb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6azcA (A:)
    gpmeepslldahnvrvvgmgselvvlghgfgtdqsvwkhviphlvddyrvilfdnmgagt
    tdpeffsfsrystlhgyaddllsileelevesciyvghsvagmvgclaslerpeiftkii
    tlsasprylndrdyfggfeqddlnqlfeamqsnfkawvsgfaplavgadidsmavqefgr
    tlfnirpdiafsvaktifqsdlrimlpkvtvpchilqsskdlavplvvadylhhalggpt
    ivevlpteghlpqlsspdiiipvlkrhlagsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6azcA (A:)
    lldahnvrvvgmgselvvlghgfgtdqsvwkhviphlvddyrvilfdnmgagttdpeffs
    fsrystlhgyaddllsileelevesciyvghsvagmvgclaslerpeiftkiitlsaspr
    ylndrdyfggfeqddlnqlfeamqsnfkawvsgfaplavgadidsmavqefgrtlfnirp
    diafsvaktifqsdlrimlpkvtvpchilqsskdlavplvvadylhhalggptivevlpt
    eghlpqlsspdiiipvlkrhlag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6azcB (B:)
    gpmeepslldahnvrvvgmgselvvlghgfgtdqsvwkhviphlvddyrvilfdnmgagt
    tdpeffsfsrystlhgyaddllsileelevesciyvghsvagmvgclaslerpeiftkii
    tlsasprylndrdyfggfeqddlnqlfeamqsnfkawvsgfaplavgadidsmavqefgr
    tlfnirpdiafsvaktifqsdlrimlpkvtvpchilqsskdlavplvvadylhhalggpt
    ivevlpteghlpqlsspdiiipvlkrhlagsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6azcB (B:)
    lldahnvrvvgmgselvvlghgfgtdqsvwkhviphlvddyrvilfdnmgagttdpeffs
    fsrystlhgyaddllsileelevesciyvghsvagmvgclaslerpeiftkiitlsaspr
    ylndrdyfggfeqddlnqlfeamqsnfkawvsgfaplavgadidsmavqefgrtlfnirp
    diafsvaktifqsdlrimlpkvtvpchilqsskdlavplvvadylhhalggptivevlpt
    eghlpqlsspdiiipvlkrhlag