PDB entry 6ayy

View 6ayy on RCSB PDB site
Description: Crystal structure of Apo fructose-1,6-bisphosphatase from Mycobacterium tuberculosis
Class: hydrolase
Keywords: Fructose-1, 6-bisphosphatase, gluconeogenesis, Class II phosphatase, HYDROLASE
Deposited on 2017-09-08, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-1,6-bisphosphatase class 2
    Species: Mycobacterium tuberculosis [TaxId:83331]
    Gene: glpX, MT1131
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WN20 (19-End)
      • expression tag (18)
    Domains in SCOPe 2.07: d6ayya1, d6ayya2
  • Chain 'B':
    Compound: Fructose-1,6-bisphosphatase class 2
    Species: Mycobacterium tuberculosis [TaxId:83331]
    Gene: glpX, MT1131
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WN20 (19-End)
      • expression tag (16-18)
    Domains in SCOPe 2.07: d6ayyb1, d6ayyb2
  • Heterogens: GOL, UNX, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ayyA (A:)
    gsshhhhhhssglvprgshmelvrvteagamaagrwvgrgdkeggdgaavdamrelvnsv
    smrgvvvigegekdhapmlyngeevgngdgpecdfavdpidgttlmskgmtnaisvlava
    drgtmfdpsavfymnkiavgpdaahvlditapiseniravakvkdlsvrdmtvcildrpr
    haqlihdvratgarirlitdgdvagaisacrphsgtdllagiggtpegiiaaaaircmgg
    aiqaqlaprddaerrkaleagydlnqvlttedlvsgenvffcatgvtdgdllkgvryypg
    gctthsivmrsksgtvrmieayhrlsklneysaidftgdssavyplp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ayyA (A:)
    hmelvrvteagamaagrwvgrgdkeggdgaavdamrelvnsvsmrgvvvigegekdhapm
    lyngeevgngdgpecdfavdpidgttlmskgmtnaisvlavadrgtmfdpsavfymnkia
    vgpdaahvlditapiseniravakvkdlsvrdmtvcildrprhaqlihdvratgarirli
    tdgdvagaisacrphsgtdllagiggtpegiiaaaaircmggaiqaqlaprddaerrkal
    eagydlnqvlttedlvsgenvffcatgvtdgdllkgvryypggctthsivmrsksgtvrm
    ieayhrlsklne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ayyB (B:)
    gsshhhhhhssglvprgshmelvrvteagamaagrwvgrgdkeggdgaavdamrelvnsv
    smrgvvvigegekdhapmlyngeevgngdgpecdfavdpidgttlmskgmtnaisvlava
    drgtmfdpsavfymnkiavgpdaahvlditapiseniravakvkdlsvrdmtvcildrpr
    haqlihdvratgarirlitdgdvagaisacrphsgtdllagiggtpegiiaaaaircmgg
    aiqaqlaprddaerrkaleagydlnqvlttedlvsgenvffcatgvtdgdllkgvryypg
    gctthsivmrsksgtvrmieayhrlsklneysaidftgdssavyplp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ayyB (B:)
    gshmelvrvteagamaagrwvgrgdkeggdgaavdamrelvnsvsmrgvvvigegekdha
    pmlyngeevgngdgpecdfavdpidgttlmskgmtnaisvlavadrgtmfdpsavfymnk
    iavgpdaahvlditapiseniravakvkdlsvrdmtvcildrprhaqlihdvratgarir
    litdgdvagaisacrphsgtdllagiggtpegiiaaaaircmggaiqaqlaprddaerrk
    aleagydlnqvlttedlvsgenvffcatgvtdgdllkgvryypggctthsivmrsksgtv
    rmieayhr