PDB entry 6ayl

View 6ayl on RCSB PDB site
Description: Human adipocyte lipid-binding protein FABP4 in complex with fluorescein
Class: lipid binding protein
Keywords: lipid binding protein
Deposited on 2017-09-08, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, adipocyte
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15090 (7-138)
      • expression tag (6)
    Domains in SCOPe 2.07: d6ayla1, d6ayla2
  • Heterogens: FLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aylA (A:)
    qqmgrgsmcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitik
    sestfknteisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddk
    lvvecvmkgvtstrvyera
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aylA (A:)
    smcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfk
    nteisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecv
    mkgvtstrvyera