PDB entry 6ay7

View 6ay7 on RCSB PDB site
Description: Cartilage homing cysteine-dense-peptides
Class: toxin
Keywords: Knottins, Cystine knot, Toxins, TOXIN
Deposited on 2017-09-07, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium channel toxin alpha-KTx 3.5
    Species: Androctonus australis [TaxId:6858]
    Gene: KTX2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45696 (2-36)
      • expression tag (0-1)
      • conflict (9)
      • conflict (16)
      • conflict (19)
      • conflict (27)
      • conflict (32)
      • conflict (38)
      • conflict (30)
      • conflict (36)
    Domains in SCOPe 2.07: d6ay7a1, d6ay7a2
  • Chain 'B':
    Compound: Potassium channel toxin alpha-KTx 3.5
    Species: Androctonus australis [TaxId:6858]
    Gene: KTX2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45696 (2-38)
      • expression tag (0-1)
      • conflict (9)
      • conflict (16)
      • conflict (19)
      • conflict (27)
      • conflict (34)
      • conflict (32)
      • conflict (38)
    Domains in SCOPe 2.07: d6ay7b1, d6ay7b2
  • Heterogens: SO4, TFA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ay7A (A:)
    gsvripvscrhsgqclrpcrdagmrfgrcmngrcdctpr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ay7B (B:)
    gsvripvscrhsgqclrpcrdagmrfgrcmngrcdctpr