PDB entry 6axb

View 6axb on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis malate synthase in complex with 2-naphthyldiketoacid
Class: TRANSFERASE/TRANSFERASE inhibitor
Keywords: Acetyltransferase, Structural Genomics, TB Structural Genomics Consortium, TBSGC, TRANSFERASE, TRANSFERASE-TRANSFERASE inhibitor complex
Deposited on 2017-09-06, released 2018-09-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate synthase g
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U3K4
      • engineered mutation (618)
    Domains in SCOPe 2.08: d6axba_
  • Heterogens: C0V, MG, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6axbA (A:)
    mtdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardel
    qaqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvp
    vlnarfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsv
    plssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhie
    ilidpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdla
    aavdkdgtaflrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfe
    gimdalftgliaihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvl
    glpqntmkigimdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrk
    gtmksqpwilayedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragasta
    wvpsptaatlhalhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdn
    ncqsilgyvvrwvdqgvgaskvpdihdvalmedratlrissqllanwlrhgvitsadvra
    slermaplvdrqnagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrre
    fkaraaekpapsdragddaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >6axbA (A:)
    tdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelq
    aqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpv
    lnarfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsvp
    lssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhiei
    lidpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaa
    alrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfegimdalftg
    liaihglkasdgplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlglpqntmkigi
    mdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkgtmksqpwila
    yedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastawvpsptaatlh
    alhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdnncqsilgyvvr
    wvdqgvgaskvpdihdvalmedratlrissqllanwlrhgvitsadvraslermaplvdr
    qnadvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrrefkaraae