PDB entry 6awr

View 6awr on RCSB PDB site
Description: Structure of PR 10 Allergen Ara h 8.01 in complex with ANS
Class: protein binding
Keywords: plant protein, peanut, allergen, protein binding
Deposited on 2017-09-06, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ara h 8 allergen
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6awra_
  • Chain 'B':
    Compound: Ara h 8 allergen
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6awrb_
  • Heterogens: 2AN, NA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6awrA (A:)
    mgvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltived
    getkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyh
    tkgdakpdeeelkkgkakgeglfraiegyvlanptqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6awrA (A:)
    gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
    etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
    kgdakpdeeelkkgkakgeglfraiegyvlanptqy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6awrB (B:)
    mgvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltived
    getkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyh
    tkgdakpdeeelkkgkakgeglfraiegyvlanptqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6awrB (B:)
    gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
    etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
    kgdakpdeeelkkgkakgeglfraiegyvlanptqy