PDB entry 6aw9

View 6aw9 on RCSB PDB site
Description: 2.55A resolution structure of SAH bound catechol O-methyltransferase (COMT) L136M from Nannospalax galili
Class: transferase
Keywords: Spalax, COMT, S-adenosylmethionine binding, TRANSFERASE
Deposited on 2017-09-05, released 2018-09-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: Nannospalax galili [TaxId:1026970]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AW9
    Domains in SCOPe 2.08: d6aw9a_
  • Chain 'B':
    Compound: Catechol O-methyltransferase
    Species: Nannospalax galili [TaxId:1026970]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AW9
    Domains in SCOPe 2.08: d6aw9b_
  • Chain 'C':
    Compound: Catechol O-methyltransferase
    Species: Nannospalax galili [TaxId:1026970]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AW9
    Domains in SCOPe 2.08: d6aw9c_
  • Heterogens: CA, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aw9A (A:)
    mgdtkeqrilryvqqhakpgdpqsvleaidtyctqkewamnvgdakgqimdeviqehnps
    lvlelgaycgysavrmarllspgarlltmeknpdyaaitqqmlnfaglqdkvtiligasq
    dlipqlkkydvdtldmvfldhwkdrylpdtilleecgllrkgtvlladnvivpgtpdfla
    yvrgsssfecthyssyleymkvvdglekavykgpsspkqplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aw9A (A:)
    dtkeqrilryvqqhakpgdpqsvleaidtyctqkewamnvgdakgqimdeviqehnpslv
    lelgaycgysavrmarllspgarlltmeknpdyaaitqqmlnfaglqdkvtiligasqdl
    ipqlkkydvdtldmvfldhwkdrylpdtilleecgllrkgtvlladnvivpgtpdflayv
    rgsssfecthyssyleymkvvdglekavykgp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6aw9B (B:)
    mgdtkeqrilryvqqhakpgdpqsvleaidtyctqkewamnvgdakgqimdeviqehnps
    lvlelgaycgysavrmarllspgarlltmeknpdyaaitqqmlnfaglqdkvtiligasq
    dlipqlkkydvdtldmvfldhwkdrylpdtilleecgllrkgtvlladnvivpgtpdfla
    yvrgsssfecthyssyleymkvvdglekavykgpsspkqplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aw9B (B:)
    dtkeqrilryvqqhakpgdpqsvleaidtyctqkewamnvgdakgqimdeviqehnpslv
    lelgaycgysavrmarllspgarlltmeknpdyaaitqqmlnfaglqdkvtiligasqdl
    ipqlkkydvdtldmvfldhwkdrylpdtilleecgllrkgtvlladnvivpgtpdflayv
    rgsssfecthyssyleymkvvdglekavykgp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6aw9C (C:)
    mgdtkeqrilryvqqhakpgdpqsvleaidtyctqkewamnvgdakgqimdeviqehnps
    lvlelgaycgysavrmarllspgarlltmeknpdyaaitqqmlnfaglqdkvtiligasq
    dlipqlkkydvdtldmvfldhwkdrylpdtilleecgllrkgtvlladnvivpgtpdfla
    yvrgsssfecthyssyleymkvvdglekavykgpsspkqplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aw9C (C:)
    tkeqrilryvqqhakpdpqsvleaidtyctqkewamnvgdakgqimdeviqehnpslvle
    lgaycgysavrmarllspgarlltmeknpdyaaitqqmlnfaglqdkvtiligasqdlip
    qlkkydvdtldmvfldhwkdrylpdtilleecgllrkgtvlladnvivpgtpdflayvrg
    sssfecthyssyleymkvvdglekavykgp