PDB entry 6avw

View 6avw on RCSB PDB site
Description: Crystal structure of Arabidopsis thaliana SOBER1 L63A
Class: hydrolase
Keywords: alpha/beta hydrolase, plant deacetylase, hypersensitive response, HYDROLASE
Deposited on 2017-09-04, released 2017-12-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-27, with a file datestamp of 2017-12-22.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxylesterase SOBER1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: SOBER1, At4g22305
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84WK4
      • engineered mutation (64)
    Domains in SCOPe 2.07: d6avwa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6avwA (A:)
    gpmartfilwlhglgdsgpanepiqtqfksselsnaswlfpsapfnpvtcnngavmrswf
    dvpeapfkvgspidessvleavknvhaiidqeiaegtnpenvficglsqggaltlasvll
    ypktlgggavlsgwvpftssiisqfpeeakktpilwshgtddrmvlfeagqaalpflkea
    gvtcefkaypglghsisnkelkyieswikrrlkgssstclqlnclkemfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6avwA (A:)
    artfilwlhglgdsgpanepiqtqfksselsnaswlfpsapfnpvtcnngavmrswfdvp
    eapfkvgspidessvleavknvhaiidqeiaegtnpenvficglsqggaltlasvllypk
    tlgggavlsgwvpftssiisqfpeeakktpilwshgtddrmvlfeagqaalpflkeagvt
    cefkaypglghsisnkelkyieswikrrlk