PDB entry 6avn

View 6avn on RCSB PDB site
Description: Crystal structure of unbound anti-HIV antibody Fab PGV19 at 2.5 A
Class: immune system
Keywords: VRC01-class lambda antibody, CD4 binding site epitope, immune system, anti-HIV neutralizing antibody
Deposited on 2017-09-03, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: PGV19 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AVN (0-End)
  • Chain 'L':
    Compound: PGV19 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AVN
    Domains in SCOPe 2.07: d6avnl1, d6avnl2
  • Heterogens: GOL, 1PE, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6avnL (L:)
    qsaltqpasvsgspgqsitisctassdfrgfssvswyqqvpgrapkllifsvnrrpsgis
    hrfsgsksgntasltisglqiedeadyhcnayeffgggtkvfvlgqpkaapsvtlfppss
    eelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltp
    eqwkshksyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6avnL (L:)
    altqpasvsgspgqsitisctassdfrgfssvswyqqvpgrapkllifsvnrrpsgishr
    fsgsksgntasltisglqiedeadyhcnayeffgggtkvfvlgqpkaapsvtlfppssee
    lqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpeq
    wkshksyscqvthegstvektvapt