PDB entry 6avk

View 6avk on RCSB PDB site
Description: Streptavidin bound to peptide-like compound KPM-6
Class: biotin binding protein
Keywords: BIOTIN BINDING PROTEIN, streptavidin
Deposited on 2017-09-02, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6avka_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6avkb_
  • Heterogens: BZ4, HDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6avkA (A:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6avkA (A:)
    agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    p
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6avkB (B:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6avkB (B:)
    eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
    gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
    k