PDB entry 6av8

View 6av8 on RCSB PDB site
Description: Exploring Cystine Dense Peptide Space to Open a Unique Molecular Toolbox
Class: toxin
Keywords: Knottins, Cystine knot, Toxins, TOXIN
Deposited on 2017-09-01, released 2018-02-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: U5-theraphotoxin-Hs1b 1
  Species: Haplopelma schmidti [TaxId:29017]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B3FIS6 (2-End)
  Domains in SCOPe 2.08: d6av8a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6av8A (A:)
  gsgcfgykcdyykgccsgyvcsptwkwcvrpgpgr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6av8A (A:)
  gcfgykcdyykgccsgyvcsptwkwcvrp