PDB entry 6av7

View 6av7 on RCSB PDB site
Description: Structure of human endothelial nitric oxide synthase heme domain in complex with HW69
Class: oxidoreductase
Keywords: nitric oxide synthase inhibitor complex heme enzyme, OXIDOREDUCTASE
Deposited on 2017-09-01, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, endothelial
    Species: Homo sapiens [TaxId:9606]
    Gene: NOS3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6av7a_
  • Chain 'B':
    Compound: Nitric oxide synthase, endothelial
    Species: Homo sapiens [TaxId:9606]
    Gene: NOS3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6av7b_
  • Chain 'C':
    Compound: Nitric oxide synthase, endothelial
    Species: Homo sapiens [TaxId:9606]
    Gene: NOS3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6av7c_
  • Chain 'D':
    Compound: Nitric oxide synthase, endothelial
    Species: Homo sapiens [TaxId:9606]
    Gene: NOS3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6av7d_
  • Heterogens: HEM, H4B, W69, BTB, ZN, GOL, CL, GD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6av7A (A:)
    apasllppapehsppsspltqppegpkfprvknwevgsitydtlsaqaqqdgpctprrcl
    gslvfprklqgrpspgppapeqllsqardfinqyyssikrsgsqaheqrlqeveaevaat
    gtyqlreselvfgakqawrnaprcvgriqwgklqvfdardcrsaqemftyicnhikyatn
    rgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrqqdgsvrgdpanveitelciqhgwt
    pgngrfdvlplllqapdeppelfllppelvlevplehptlewfaalglrwyalpavsnml
    leigglefpaapfsgwymsteigtrnlcdphryniledvavcmdldtrttsslwkdkaav
    einvavlhsyqlakvtivdhhaatasfmkhleneqkarggcpadwawivppisgsltpvf
    hqemvnyflspafryqpdpw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6av7A (A:)
    fprvknwevgsitydtlsaqaqqdgpctprrclgslvfprklapeqllsqardfinqyys
    sikrsgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcvgriqwgklqvf
    dardcrsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrq
    qdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfllppelvlevple
    hptlewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtrnlcdphrynil
    edvavcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaatasfmkhleneqk
    arggcpadwawivppisgsltpvfhqemvnyflspafryqpdpw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6av7B (B:)
    apasllppapehsppsspltqppegpkfprvknwevgsitydtlsaqaqqdgpctprrcl
    gslvfprklqgrpspgppapeqllsqardfinqyyssikrsgsqaheqrlqeveaevaat
    gtyqlreselvfgakqawrnaprcvgriqwgklqvfdardcrsaqemftyicnhikyatn
    rgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrqqdgsvrgdpanveitelciqhgwt
    pgngrfdvlplllqapdeppelfllppelvlevplehptlewfaalglrwyalpavsnml
    leigglefpaapfsgwymsteigtrnlcdphryniledvavcmdldtrttsslwkdkaav
    einvavlhsyqlakvtivdhhaatasfmkhleneqkarggcpadwawivppisgsltpvf
    hqemvnyflspafryqpdpw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6av7B (B:)
    kfprvknwevgsitydtlsaqaqqdgpctprrclgslvfpapeqllsqardfinqyyssi
    krsgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcvgriqwgklqvfda
    rdcrsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrqqd
    gsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfllppelvlevplehp
    tlewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtrnlcdphryniled
    vavcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaatasfmkhleneqkar
    ggcpadwawivppisgsltpvfhqemvnyflspafryqpdpw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6av7C (C:)
    apasllppapehsppsspltqppegpkfprvknwevgsitydtlsaqaqqdgpctprrcl
    gslvfprklqgrpspgppapeqllsqardfinqyyssikrsgsqaheqrlqeveaevaat
    gtyqlreselvfgakqawrnaprcvgriqwgklqvfdardcrsaqemftyicnhikyatn
    rgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrqqdgsvrgdpanveitelciqhgwt
    pgngrfdvlplllqapdeppelfllppelvlevplehptlewfaalglrwyalpavsnml
    leigglefpaapfsgwymsteigtrnlcdphryniledvavcmdldtrttsslwkdkaav
    einvavlhsyqlakvtivdhhaatasfmkhleneqkarggcpadwawivppisgsltpvf
    hqemvnyflspafryqpdpw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6av7C (C:)
    fprvknwevgsitydtlsaqaqqdgpctprrclgslvfpapeqllsqardfinqyyssik
    rsgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcvgriqwgklqvfdar
    dcrsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrqqdg
    svrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfllppelvlevplehpt
    lewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtrnlcdphryniledv
    avcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaatasfmkhleneqkarg
    gcpadwawivppisgsltpvfhqemvnyflspafryqpdpw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6av7D (D:)
    apasllppapehsppsspltqppegpkfprvknwevgsitydtlsaqaqqdgpctprrcl
    gslvfprklqgrpspgppapeqllsqardfinqyyssikrsgsqaheqrlqeveaevaat
    gtyqlreselvfgakqawrnaprcvgriqwgklqvfdardcrsaqemftyicnhikyatn
    rgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrqqdgsvrgdpanveitelciqhgwt
    pgngrfdvlplllqapdeppelfllppelvlevplehptlewfaalglrwyalpavsnml
    leigglefpaapfsgwymsteigtrnlcdphryniledvavcmdldtrttsslwkdkaav
    einvavlhsyqlakvtivdhhaatasfmkhleneqkarggcpadwawivppisgsltpvf
    hqemvnyflspafryqpdpw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6av7D (D:)
    kfprvknwevgsitydtlsaqaqqdgpctprrclgslvfpapeqllsqardfinqyyssi
    krsgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcvgriqwgklqvfda
    rdcrsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrqqd
    gsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfllppelvlevplehp
    tlewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtrnlcdphryniled
    vavcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaatasfmkhleneqkar
    ggcpadwawivppisgsltpvfhqemvnyflspafryqpdpw