PDB entry 6auy

View 6auy on RCSB PDB site
Description: Structure of human neuronal nitric oxide synthase R354A/G357D mutant heme domain in complex with 4-Methyl-6-(3-(3-(methylamino)propyl)phenethyl)pyridin-2-amine
Class: oxidoreductase
Keywords: nitric oxide synthase inhibitor complex heme enzyme, OXIDOREDUCTASE
Deposited on 2017-09-01, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, brain
    Species: Homo sapiens [TaxId:9606]
    Gene: NOS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29475 (0-420)
      • engineered mutation (52)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d6auya_
  • Chain 'B':
    Compound: Nitric oxide synthase, brain
    Species: Homo sapiens [TaxId:9606]
    Gene: NOS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29475
      • engineered mutation (52)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d6auyb_
  • Heterogens: HEM, H4B, ZN, BYJ, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6auyA (A:)
    cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfp
    lakefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    dycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >6auyA (A:)
    cprflkvknwetevvltdtlhlkstletgcteyicmgsimhppedvatkdqlfplakefi
    dqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgriqws
    klqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliry
    agykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqippelvl
    evpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdns
    rynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhm
    eneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6auyB (B:)
    cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfp
    lakefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    dycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >6auyB (B:)
    rflkvknwetevvltdtlhlkstletgcteyicmgsimhpsatkdqlfplakefidqyys
    sikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgriqwsklqvf
    dardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykq
    pdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqippelvlevpir
    hpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsrynil
    eevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyr
    crggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw