PDB entry 6aum

View 6aum on RCSB PDB site
Description: Crystal structure of human soluble epoxide hydrolase complexed with trans-4-[4-(3-trifluoromethoxyphenyl-l-ureido)-cyclohexyloxy]-benzoic acid.
Class: hydrolase/hydrolase inhibitor
Keywords: soluble epoxide hydrolase, urea inhibitors, neuropathic pain, HYDROLASE, hydrolase-hydrolase inhibitor complex
Deposited on 2017-09-01, released 2018-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional epoxide hydrolase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHX2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6auma1, d6auma2
  • Heterogens: PO4, MG, BXV, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aumA (A:)
    mtlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitl
    sqwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgftta
    iltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsev
    vflddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpaplptscnpsdmshg
    yvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgygess
    appeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravaslnt
    pfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvlsmh
    kvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwacksl
    grkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqilik
    wldsdarnppvvskm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aumA (A:)
    tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls
    qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai
    ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv
    flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpaplptscnpsdmshgy
    vtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgygessa
    ppeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravaslntp
    fipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvlsmhk
    vceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwackslg
    rkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqilikw
    ldsdarn