PDB entry 6aul

View 6aul on RCSB PDB site
Description: Artificial Metalloproteins Containing a Co4O4 Active Site - 2xm-S112Y-b
Class: biotin-binding protein
Keywords: streptavidin, biotin, artificial metalloprotein, Co4O4, photosynthesis, water oxidation, biomimetic, BIOTIN-BINDING PROTEIN
Deposited on 2017-09-01, released 2018-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (13-End)
      • expression tag (10-12)
      • engineered mutation (100)
      • engineered mutation (111)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d6aula1, d6aula2
  • Heterogens: BTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aulA (A:)
    masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaqarintqwlltygtteanaw
    astlvghdtftkvkpsaasidaakkagvnngnpldavqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aulA (A:)
    grdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnyrnahsattwsgqyvggaqarintqwlltygtteanawastlvghdtf
    tkv