PDB entry 6auf

View 6auf on RCSB PDB site
Description: Crystal structure of Metalo beta Lactamases MIM-1 from Novosphingobium pentaromativorans
Class: hydrolase
Keywords: metallohydrolase, lactamase, HYDROLASE
Deposited on 2017-08-31, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Beta-lactamase-like protein
    Species: Novosphingobium pentaromativorans US6-1 [TaxId:1088721]
    Gene: NSU_3853
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aufb_
  • Heterogens: ZN, CIT, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6aufB (B:)
    mhhhhhhlevlfqgprdsaakaapttlatackgldgregwshpappahiygntwyvgtcg
    iasilvtsddghvlidsgpadaaplvlanirklgfdpadvrwiltshehhdhagsiaelq
    katgaqiaavasarqvlesgkpsaddpqsgliegfppvhvarvlvdgdsvtlgrlaltvr
    etpahspgsaswtwqacdeaftcrmiayadsattisaddyrfsdhpdriarirtglsria
    qlpcdilvtphpsasnlfdrlsgkaplvnaqacaaysqaagsyfakrlaeeageaaqefp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aufB (B:)
    pttlatackgldgregwshpappahiygntwyvgtcgiasilvtsddghvlidsgpadaa
    plvlanirklgfdpadvrwiltshehhdhagsiaelqkatgaqiaavasarqvlesgkps
    addpqsgliegfppvhvarvlvdgdsvtlgrlaltvretpahspgsaswtwqacdeaftc
    rmiayadsattisaddyrfsdhpdriarirtglsriaqlpcdilvtphpsasnlfdrlsg
    kaplvnaqacaaysqaagsyfakrlaeeageaa