PDB entry 6atp

View 6atp on RCSB PDB site
Description: Crystal structure of apo-hGSTA1-1 exhibiting a new conformation of C-terminal helix
Class: transferase
Keywords: Glutathione S-transferase, glutathione transferase, GST, hGSTA1-1, apo, TRANSFERASE
Deposited on 2017-08-29, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6atpa1, d6atpa2
  • Chain 'B':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6atpb1, d6atpb2
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6atpA (A:)
    aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleearkifrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6atpB (B:)
    aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6atpB (B:)
    ekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveidg
    mklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdakla
    likekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpllk
    alktrisnlptvkkflqpgsprkppmdeksleearkifrf