PDB entry 6ate

View 6ate on RCSB PDB site
Description: SRC kinase bound to covalent inhibitor
Class: transferase/transferase inhibitor
Keywords: kinase, phosphorylation, transferase-transferase inhibitor complex, transferase
Deposited on 2017-08-28, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC, SRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6atea_
  • Heterogens: 6H3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ateA (A:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ateA (A:)
    kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlpeafeaqvmkklrheklvq
    lyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmayvermnyvh
    rdlraanilvgenlvckvadfglarlpikwtapeaalygrftiksdvwsfgilltelttk
    grvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkepeerptfeylqafled
    yftstepqyqpgenl