PDB entry 6atd

View 6atd on RCSB PDB site
Description: Oxidized SHP2 forms a disulfide bond between Cys367 and Cys459
Class: hydrolase
Keywords: hydrolase
Deposited on 2017-08-28, released 2018-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124
      • engineered mutation (309)
    Domains in SCOPe 2.08: d6atda1, d6atda2, d6atda3
  • Chain 'B':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124
      • engineered mutation (309)
    Domains in SCOPe 2.08: d6atdb1, d6atdb2, d6atdb3
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6atdA (A:)
    ghmtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqn
    tgdyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghls
    gkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelk
    ydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklae
    ttdkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpn
    epvsdyinadiimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttk
    evergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqy
    hfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidi
    irekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6atdA (A:)
    tsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgd
    yydlyggekfatlaelvqyymehhgqlkegdvielkyplncadptserwfhghlsgkeae
    klltekgkhgsflvresqshpgdfvlsvrtgddgkskvthvmircqelkydvgggerfds
    ltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelskqgfweefetlqqqe
    ckllysrkegqrqenknknryknilpfdhtrvvlhdgdppvsdyinadiimpepkksyia
    tqgclqntvndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvk
    esaahdytlrelklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesi
    mdagpvvvhcsagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqtea
    qyrfiymavqhyietl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6atdB (B:)
    ghmtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqn
    tgdyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghls
    gkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelk
    ydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklae
    ttdkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpn
    epvsdyinadiimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttk
    evergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqy
    hfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidi
    irekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6atdB (B:)
    tsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgd
    yydlyggekfatlaelvqyymehhgqlkegdvielkyplncadptserwfhghlsgkeae
    klltekgkhgsflvresqshpgdfvlsvrtgdgkskvthvmircqelkydvgggerfdsl
    tdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelskqgfweefetlqqqec
    kllysrkegqrqenknknryknilpfdhtrvvlhdgdppvsdyinadiimpekksyiatq
    gclqntvndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkes
    aahdytlrelklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimd
    agpvvvhcsagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqy
    rfiymavqhyietl