PDB entry 6at4

View 6at4 on RCSB PDB site
Description: E. coli phosphoenolpyruvate carboxykinase bound to thiosulfate
Class: lyase
Keywords: Nonnative ligand, LYASE
Deposited on 2017-08-27, released 2018-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase (ATP)
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: pckA, pck, b3403, JW3366
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6at4a1, d6at4a2
  • Chain 'B':
    Compound: Phosphoenolpyruvate carboxykinase (ATP)
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: pckA, pck, b3403, JW3366
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6at4b1, d6at4b2
  • Heterogens: THJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6at4A (A:)
    mrvnngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtg
    iftgrspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfv
    vdafcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqw
    keqglnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgek
    gdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepei
    ynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifl
    tadafgvlppvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptq
    yaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnl
    aiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6at4A (A:)
    gltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgr
    spkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafc
    ganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgl
    nsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgekgdvav
    ffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepeiynair
    rdallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifltadaf
    gvlppvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptqyaevl
    vkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnlaipte
    lpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6at4B (B:)
    mrvnngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtg
    iftgrspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfv
    vdafcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqw
    keqglnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgek
    gdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepei
    ynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifl
    tadafgvlppvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptq
    yaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnl
    aiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6at4B (B:)
    ltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgrs
    pkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcg
    anpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgln
    senfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgekgdvavf
    fglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepeiynairr
    dallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifltadafg
    vlppvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptqyaevlv
    krmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnlaiptel
    pgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl