PDB entry 6asv

View 6asv on RCSB PDB site
Description: E. coli PRPP Synthetase
Class: transferase
Keywords: nucleotide biosynthesis phosphoribosyl pyrophosphate KPRS, TRANSFERASE
Deposited on 2017-08-25, released 2019-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribose-phosphate pyrophosphokinase
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: prs, prsA, Z1978, ECs1712
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6asva1, d6asva2
  • Chain 'B':
    Compound: Ribose-phosphate pyrophosphokinase
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: prs, prsA, Z1978, ECs1712
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6asvb1, d6asvb2
  • Chain 'C':
    Compound: Ribose-phosphate pyrophosphokinase
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: prs, prsA, Z1978, ECs1712
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6asvc1, d6asvc2
  • Heterogens: PO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6asvA (A:)
    mgsshhhhhhssglvprgshmpdmklfagnatpelaqrianrlytslgdaavgrfsdgev
    svqinenvrggdifiiqstcaptndnlmelvvmvdalrrasagritavipyfgyarqdrr
    vrsarvpitakvvadflssvgvdrvltvdlhaeqiqgffdvpvdnvfgspilledmlqln
    ldnpivvspdiggvvraraiakllndtdmaiidkrrpranvsqvmhiigdvagrdcvlvd
    dmidtggtlckaaealkergakrvfayathpifsgnaannlrnsvidevvvcdtiplsde
    ikslpnvrtltlsgmlaeairrisneesisamfeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6asvA (A:)
    pdmklfagnatpelaqrianrlytslgdaavgrfsdgevsvqinenvrggdifiiqstca
    ptndnlmelvvmvdalrrasagritavipyfgyarqdrrvrsarvpitakvvadflssvg
    vdrvltvdlhaeqiqgffdvpvdnvfgspilledmlqlnldnpivvspdiggvvraraia
    kllndtdmaiidkrvmhiigdvagrdcvlvddmidtggtlckaaealkergakrvfayat
    hpifsgnaannlrnsvidevvvcdtiplsdeikslpnvrtltlsgmlaeairrisneesi
    samfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6asvB (B:)
    mgsshhhhhhssglvprgshmpdmklfagnatpelaqrianrlytslgdaavgrfsdgev
    svqinenvrggdifiiqstcaptndnlmelvvmvdalrrasagritavipyfgyarqdrr
    vrsarvpitakvvadflssvgvdrvltvdlhaeqiqgffdvpvdnvfgspilledmlqln
    ldnpivvspdiggvvraraiakllndtdmaiidkrrpranvsqvmhiigdvagrdcvlvd
    dmidtggtlckaaealkergakrvfayathpifsgnaannlrnsvidevvvcdtiplsde
    ikslpnvrtltlsgmlaeairrisneesisamfeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6asvB (B:)
    dmklfagnatpelaqrianrlytslgdaavgrfsdgevsvqinenvrggdifiiqstcap
    tndnlmelvvmvdalrrasagritavipyfgyarqdrrvrsarvpitakvvadflssvgv
    drvltvdlhaeqiqgffdvpvdnvfgspilledmlqlnldnpivvspdiggvvraraiak
    llndtdmaiidkrvmhiigdvagrdcvlvddmidtggtlckaaealkergakrvfayath
    pifsgnaannlrnsvidevvvcdtiplsdeikslpnvrtltlsgmlaeairrisneesis
    amf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6asvC (C:)
    mgsshhhhhhssglvprgshmpdmklfagnatpelaqrianrlytslgdaavgrfsdgev
    svqinenvrggdifiiqstcaptndnlmelvvmvdalrrasagritavipyfgyarqdrr
    vrsarvpitakvvadflssvgvdrvltvdlhaeqiqgffdvpvdnvfgspilledmlqln
    ldnpivvspdiggvvraraiakllndtdmaiidkrrpranvsqvmhiigdvagrdcvlvd
    dmidtggtlckaaealkergakrvfayathpifsgnaannlrnsvidevvvcdtiplsde
    ikslpnvrtltlsgmlaeairrisneesisamfeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6asvC (C:)
    dmklfagnatpelaqrianrlytslgdaavgrfsdgevsvqinenvrggdifiiqstcap
    tndnlmelvvmvdalrrasagritavipyfgyarqdrrvrsarvpitakvvadflssvgv
    drvltvdlhaeqiqgffdvpvdnvfgspilledmlqlnldnpivvspdiggvvraraiak
    llndtdmaiidkrrpranvsqvmhiigdvagrdcvlvddmidtggtlckaaealkergak
    rvfayathpifsgnaannlrnsvidevvvcdtiplsdeikslpnvrtltlsgmlaeairr
    isneesisamf