PDB entry 6asl

View 6asl on RCSB PDB site
Description: Crystal Structure of Flavin monooxygenase CmoJ (earlier YtnJ) bound with FMN
Class: flavoprotein
Keywords: Flavin monooxygenase, FLAVOPROTEIN
Deposited on 2017-08-24, released 2018-09-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative monooxygenase MoxC
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: moxC, ytnJ, BSU29310
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6asla_
  • Heterogens: FMN, LFN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aslA (A:)
    ghmtradfiqfgamihgvggttdgwrhpdvdpsastniefymkkaqtaekglfsfifiad
    glfiseksiphflnrfepitilsalasvtkniglvgtfstsftepftisrqlmsldhisg
    gragwnlvtspqegaarnhsksnlpehteryeiaqehldvvrglwnswehdafihnkktg
    qffdqaklhrlnhkgkyfqvegplnigrskqgepvvfqagssetgrqfaaknadaifths
    nsleetkafyadvksraadegrdpssvrifpgispivadteeeaekkyrefaelipiena
    vtylarffddydlsvypldepfpdigdvgknafqsttdrikreakarnltlrevaqemaf
    prtlfigtpervaslietwfnaeaadgfivgsdipgtldafvekvipilqerglyrqdyr
    ggtlrenlglgipqhqsvlhsshh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aslA (A:)
    radfiqfgamihgvggttdgwrhpdvdpsastniefymkkaqtaekglfsfifiadglfi
    seksiphflnrfepitilsalasvtkniglvgtfstsftepftisrqlmsldhisggrag
    wnlvtspqegaarnhsksnlpehteryeiaqehldvvrglwnswehdafihnkktgqffd
    qaklhrlnhkgkyfqvegplnigrskqgepvvfqagssetgrqfaaknadaifthsnsle
    etkafyadvksraadegrdpssvrifpgispivadteeeaekkyrefaelipienavtyl
    arffddydlsvypldepfpdigdvgknafqsttdrikreakarnltlrevaqemafprtl
    figtpervaslietwfnaeaadgfivgsdipgtldafvekvipilqerglyrqdyrggtl
    renlglgipq