PDB entry 6ask

View 6ask on RCSB PDB site
Description: Crystal Structure of apo Flavin monooxygenase CmoJ (earlier YtnJ)
Class: flavoprotein, oxidoreductase
Keywords: Flavin monooxygenase, FLAVOPROTEIN, OXIDOREDUCTASE
Deposited on 2017-08-24, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative monooxygenase MoxC
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Gene: moxC, ytnJ, BSU29310
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aska_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6askA (A:)
    ghmtradfiqfgamihgvggttdgwrhpdvdpsastniefymkkaqtaekglfsfifiad
    glfiseksiphflnrfepitilsalasvtkniglvgtfstsftepftisrqlmsldhisg
    gragwnlvtspqegaarnhsksnlpehteryeiaqehldvvrglwnswehdafihnkktg
    qffdqaklhrlnhkgkyfqvegplnigrskqgepvvfqagssetgrqfaaknadaifths
    nsleetkafyadvksraadegrdpssvrifpgispivadteeeaekkyrefaelipiena
    vtylarffddydlsvypldepfpdigdvgknafqsttdrikreakarnltlrevaqemaf
    prtlfigtpervaslietwfnaeaadgfivgsdipgtldafvekvipilqerglyrqdyr
    ggtlrenlglgipqhqsvlhsshh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6askA (A:)
    radfiqfgamihgvggttdgwrhpdvdpsastniefymkkaqtaekglfsfifiadglfi
    seksiphflnrfepitilsalasvtkniglvgtfstsftepftisrqlmsldhisggrag
    wnlvtspqegaarnhsksnlpehteryeiaqehldvvrglwnswehdafihnkktgqffd
    qaklhrlnhkgkyfqvegplnigrskqgepvvfqagssetgrqfaaknadaifthsnsle
    etkafyadvksraadegrdpssvrifpgispivadteeeaekkyrefaelipienavtyl
    arffddydlsvypldepfpdigdvgknafqsttdrikreakarnltlrevaqemafprtl
    figtpervaslietwfnaeaadgfivgsdipgtldafvekvipilqerglyrqdyrggtl
    renlglgipq