PDB entry 6asa

View 6asa on RCSB PDB site
Description: KRAS mutant-D33E in GDP-bound
Class: hydrolase
Keywords: KRAS D33E-GDP structure, HYDROLASE
Deposited on 2017-08-24, released 2018-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (0-167)
      • engineered mutation (32)
    Domains in SCOPe 2.07: d6asaa_
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6asaA (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdeyeptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
    psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke