PDB entry 6as9

View 6as9 on RCSB PDB site
Description: Filamentous Assembly of Green Fluorescent Protein Supported by a C-terminal fusion of 18-residues, viewed in space group P212121 form 2
Class: protein fibril
Keywords: filament, protofilament, 2 sub 1 screw symmetry, PROTEIN FIBRIL
Deposited on 2017-08-23, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212 (Start-235)
      • chromophore (64)
      • conflict (65)
      • conflict (69)
      • expression tag (236-245)
    Domains in SCOPe 2.07: d6as9a1, d6as9a2
  • Heterogens: ACT, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6as9A (A:)
    mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttfxlqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
    ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
    qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelykamak
    etaaakfdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6as9A (A:)
    skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
    ttfxlqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
    elkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyq
    qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelykamake
    taaak