PDB entry 6ark

View 6ark on RCSB PDB site
Description: Crystal Structure of compound 10 covalently bound to K-Ras G12C
Class: signaling protein/inhibitor
Keywords: DOCKovalent, covalent docking, K-Ras G12C, covalent inhibitors, covalent fragments, SIGNALING PROTEIN, signaling protein-inhibitor complex
Deposited on 2017-08-22, released 2018-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-169)
      • expression tag (0)
      • engineered mutation (12)
      • engineered mutation (51)
      • engineered mutation (80)
      • engineered mutation (118)
    Domains in SCOPe 2.08: d6arka1, d6arka2
  • Heterogens: BQD, GDP, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6arkA (A:)
gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildta
gqeeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek

    Sequence, based on observed residues (ATOM records): (download) 
    >6arkA (A:)
gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildta
gqemrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlpsr
tvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek