PDB entry 6ari

View 6ari on RCSB PDB site
Description: Crystal structure of a dephospho-CoA kinase from Escherichia coli in complex with inhibitor CM078
Class: Transferase/Transferase Inhibitor
Keywords: SSGCID, dephospho-CoA kinase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, Transferase-Transferase Inhibitor complex
Deposited on 2017-08-22, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dephospho-coa kinase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: coaE, yacE, b0103, JW0100
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aria_
  • Chain 'B':
    Compound: dephospho-coa kinase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: coaE, yacE, b0103, JW0100
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6arib_
  • Heterogens: BQV, CIT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ariA (A:)
    mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia
    adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl
    ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd
    aiasdvarlhahylqlasqfvsqekpgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ariA (A:)
    mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia
    adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl
    ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd
    aiasdvarlhahylqlasqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ariB (B:)
    mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia
    adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl
    ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd
    aiasdvarlhahylqlasqfvsqekpgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ariB (B:)
    mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia
    adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl
    ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd
    aiasdvarlhahylqlasqfvsq