PDB entry 6ar4

View 6ar4 on RCSB PDB site
Description: Crystal structure of PICK1 in complex with the small molecule inhibitor 31596
Class: Actin Binding protein
Keywords: PDZ domain PDZ inhibitor, Actin Binding protein
Deposited on 2017-08-21, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PRKCA-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PICK1, PRKCABP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ar4a_
  • Chain 'B':
    Compound: PRKCA-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PICK1, PRKCABP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ar4b_
  • Heterogens: BQA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ar4A (A:)
    mghhhhhhhhlvprgsmfadldydieedklgiptvpgkvtlqkdaqnligisigggaqyc
    pclyivqvfdntpaaldgtvaagdeitgvngrsikgktkvevakmiqevkgevtihynkl
    qqsav
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ar4A (A:)
    vpgkvtlqkdaqnligisigggaqycpclyivqvfdntpaaldgtvaagdeitgvngrsi
    kgktkvevakmiqevkgevtihynkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ar4B (B:)
    mghhhhhhhhlvprgsmfadldydieedklgiptvpgkvtlqkdaqnligisigggaqyc
    pclyivqvfdntpaaldgtvaagdeitgvngrsikgktkvevakmiqevkgevtihynkl
    qqsav
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ar4B (B:)
    tvpgkvtlqkdaqnligisigggaqycpclyivqvfdntpaaldgtvaagdeitgvngrs
    ikgktkvevakmiqevkgevtihynkl