PDB entry 6aqu

View 6aqu on RCSB PDB site
Description: Crystal Structure of Plasmodium falciparum purine nucleoside phosphorylase: The M183L mutant
Class: transferase
Keywords: Plasmodium falciparum, Purine nucleoside phosphorylase (PNP), PNP mutation, drug resistant PNP., TRANSFERASE
Deposited on 2017-08-21, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PNP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T9Z7 (Start-246)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d6aqua_
  • Chain 'B':
    Compound: purine nucleoside phosphorylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PNP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T9Z7 (Start-246)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d6aqub_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aquA (A:)
    gsmdnllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqk
    flcvshgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvs
    hllihgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskana
    avvelelatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgaca
    klatkya
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aquA (A:)
    nllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcv
    shgvgcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshllihgd
    fpavgdfdvydtlnkcaqelnvpvfngisvssdmysrledyskanaavvelelatlmvig
    tlrkvktggilivdgcphqlenmikialgacaklatkya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6aquB (B:)
    gsmdnllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqk
    flcvshgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvs
    hllihgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskana
    avvelelatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgaca
    klatkya
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aquB (B:)
    nllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcv
    shgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshlli
    hgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmpsrledyskanaavvelelatlm
    vigtlrkvktggilivdgcpphqlenmikialgacaklatkya