PDB entry 6aq6

View 6aq6 on RCSB PDB site
Description: X-ray crystal structure of Erythrina crista-galli lectin in complex with N-acetyllactosamine
Class: sugar binding protein
Keywords: carbohydrate binding protein, lectin, N-acetyllactosamine, SUGAR BINDING PROTEIN
Deposited on 2017-08-18, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: ERYTHRINA CRISTA-GALLI [TaxId:49817]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aq6a_
  • Chain 'B':
    Compound: lectin
    Species: ERYTHRINA CRISTA-GALLI [TaxId:49817]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aq6b_
  • Heterogens: NAG, GAL, FUC, BMA, XYP, MAN, CA, MN, NA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6aq6A (A:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6aq6B (B:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpe