PDB entry 6aq5

View 6aq5 on RCSB PDB site
Description: X-ray crystal structure of Erythrina crista-galli lectin in complex with epilactose
Class: sugar binding protein
Keywords: carbohydrate binding protein, lectin, epilactose, SUGAR BINDING PROTEIN
Deposited on 2017-08-18, released 2018-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: ERYTHRINA CRISTA-GALLI [TaxId:49817]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6aq5a_
  • Chain 'B':
    Compound: lectin
    Species: ERYTHRINA CRISTA-GALLI [TaxId:49817]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6aq5b_
  • Heterogens: MN, CA, NA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6aq5A (A:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6aq5B (B:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpe