PDB entry 6apz

View 6apz on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis malate synthase in complex with 3-hydroxy-phenyldiketoacid
Class: transferase
Keywords: Acetyltransferase, Structural Genomics, TB Structural Genomics Consortium, TBSGC, TRANSFERASE
Deposited on 2017-08-18, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate synthase g
    Species: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) [TaxId:419947]
    Gene: glcB, MRA_1848
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U3K4
      • engineered mutation (618)
    Domains in SCOPe 2.07: d6apza_
  • Heterogens: BQ4, MG, NI, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6apzA (A:)
    mtdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardel
    qaqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvp
    vlnarfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsv
    plssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhie
    ilidpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdla
    aavdkdgtaflrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfe
    gimdalftgliaihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvl
    glpqntmkigimdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrk
    gtmksqpwilayedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragasta
    wvpsptaatlhalhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdn
    ncqsilgyvvrwvdqgvgaskvpdihdvalmedratlrissqllanwlrhgvitsadvra
    slermaplvdrqnagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrre
    fkaraaekpapsdragddaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >6apzA (A:)
    tdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelq
    aqidkwhrrepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpvlna
    rfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsvplss
    gsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhieilid
    pesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaarvl
    nrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfegimdalftgliaih
    glkasdplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlglpqntmkigimdeerr
    ttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkgtmksqpwilayedhnv
    daglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastawvpsptaatlhalhyhq
    vdvaavqqglagkrratieqlltiplakelawapdeireevdnncqsilgyvvrwvdqgv
    gaskvpdihdvalmedratlrissqllanwlrhgvitsadvraslermaplvdrqnvayr
    pmapnfddsiaflaaqelilsgaqqpngytepilhrrrrefkaraae