PDB entry 6apu

View 6apu on RCSB PDB site
Description: Crystal structure of Trypanosoma brucei hypoxanthine-guanine phosphoribosyltranferase in complex with (2-{[2-(2-amino-6-oxo-1,6-dihydro-9H-purin-9-yl)ethyl](3-aminopropyl)amino}ethyl)phosphonic acid
Class: transferase
Keywords: Purine salvage, acyclic nucleoside phosphonate, TRANSFERASE
Deposited on 2017-08-18, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: HGPRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6apua_
  • Chain 'B':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: HGPRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6apub_
  • Heterogens: SO4, MG, PEG, 3L6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6apuA (A:)
    hhhhhhmepackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlk
    gsfvftadmvrilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvled
    ildtaltlrevvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldy
    dqsyrevrdvvilkpsvyetwgkelerrkaageakr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6apuA (A:)
    ckydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmv
    rilgdfgvptrveflrassydirgkhvlvledildtaltlrevvdslkksepasiktlva
    idkpggrkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetwgkel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6apuB (B:)
    hhhhhhmepackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlk
    gsfvftadmvrilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvled
    ildtaltlrevvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldy
    dqsyrevrdvvilkpsvyetwgkelerrkaageakr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6apuB (B:)
    ackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadm
    vrilgdfgvptrveflrdirgkhvlvledildtaltlrevvdslkksepasiktlvaidk
    pggrkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetwgkelerr